Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G26097-10 10 µg $275 
LS-G26097-50 50 µg $441 
LS-G26097-100 100 µg $703 
LS-G26097-200 200 µg $879 
LS-G26097-1 1 mg $1,946 
AXL Protein - Recombinant  AXL Receptor Tyrosine Kinase By SDS-PAGE

Rat AXL Protein (Recombinant His-S) (aa21-202) - LS-G26097

Rat AXL Protein (Recombinant His-S) (aa21-202) - LS-G26097

Description:
AXL Protein LS-G26097 is a Recombinant Rat AXL produced in E. coli aa 21-202 with His-S tag(s).
Price
Catalog Number
$275
LS-G26097-10
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
AXL Protein LS-G26097 is a Recombinant Rat AXL produced in E. coli aa 21-202 with His-S tag(s).

Specifications

Type
Recombinant Protein
Target
AXL
Synonyms
AXL | AXL transforming sequence/gene | Oncogene AXL | AXL oncogene | AXL receptor tyrosine kinase | JTK11 | Tyro7 | UFO
Species
Rat
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His-S
Region
aa 21-202
Predicted Molecular Weight
23.5 kDa
AA Sequence
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFKDTQTEADSPFVGNPGNITGARGLTGTLRCELQVQGEPPEVMWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVAGYSFQHSLQAPGLNKTSSFSCEAH
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from PBS, pH 7.4, 1 mM DTT, 5% Trehalose, 0.01% Sarcosyl, ProClin™ 300
Storage
Store at 4°C for up to 1 month, or aliquot and store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About AXL
P30530 NM_001699 NP_001690.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

AXL Protein - Recombinant  AXL Receptor Tyrosine Kinase By SDS-PAGE
Recombinant AXL Receptor Tyrosine Kinase By SDS-PAGE

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

AXL Protein - Recombinant  AXL Receptor Tyrosine Kinase By SDS-PAGE
Recombinant AXL Receptor Tyrosine Kinase By SDS-PAGE

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

AXL Protein - Recombinant  AXL Receptor Tyrosine Kinase By SDS-PAGE
Recombinant AXL Receptor Tyrosine Kinase By SDS-PAGE

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

AXL Protein - Recombinant  AXL Receptor Tyrosine Kinase By SDS-PAGE
Recombinant AXL Receptor Tyrosine Kinase By SDS-PAGE

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/15/2021