Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

Human ZNF583 Protein (Over-Expression Lysate Myc + DDK) (Full Length) - LS-G93785

Best Seller
Catalog
Size
Price
LS-G93785-20
20 µg
$195
Description
ZNF583 Protein LS-G93785 is Over-Expression Lysate Human ZNF583 in Human with Myc + DDK tag(s).
Type
Over-Expression Lysate Protein
Target
ZNF583
Species
Human
Predicted Molecular Weight
65.9 kDa Full Length
Details
This product includes lyophilized lysate of HEK293T cells that have been transiently-tranfected with Human ZNF583 (NM_001159860) and is intended for use as a Western blot positive control. Cells were lysed using Modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix and 1mM Na3VO4). See related products for a larger volume of this lysate supplied with a vector only control and 2x SDS-Page load buffer, or the purified form of this recombinant protein.
AA Sequence
MSKDLVTFGDVAVNFSQEEWEWLNPAQRNLYRKVMLENYRSLVSLGVSVSKPDVISLLEQGKEPWMVKKEGTRGPCPDWEYVFKNSEFSSKQETYEESSKVVTVGARHLSYSLDYPSLREDCQSEDWYKNQLGSQEVHLSQLIITHKEILPEVQNKEYNKSWQTFHQDTIFDIQQSFPTKEKAHKHEPQKKSYRKKSVEMKHRKVYVEKKLLKCNDCEKVFNQSSSLTLHQRIHTGEKPYACVECGKTFSQSANLAQHKRIHTGEKPYECKECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAFSQIAHLTQHQRVHTGERPFECIECGKAFSNGSFLAQHQRIHTGEKPYVCNVCGKAFSHRGYLIVHQRIHTGERPYECKECRKAFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQIAYLDQHQRVHTGEKPYECIECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLAQHQRIHTGEKPYECNVCGKAFSYSGSLTLHQRIHTGERPYECKDCRKSFRQRAHLAHHERIHTMESFLTLSSPSPSTSNQLPRPVGFIS(CloningSiteandTags:myc-FLAG tag)
Expression System
293T Cells
Source Species
Human
Tag
Myc + DDK
Purification
Unpurified
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized
Reconstitution
Reconstitute with SDS Sample Buffer
Storage
Store at -20°C for up to 1 year. Avoid freeze-thaw cycles.
Usage Summary
Western blot: Spin down briefly and resuspend in 2X SDS Sample Buffer (4% SDS, 125mM Tris-HCl pH6.8, 10% Glycerol, 0.002% Bromphenol blue, 100mM DTT). Prior to SDS-PAGE fractionation, boil the lysate for 5 minutes.
Restrictions
For research use only.
About ZNF583
Q96ND8 Q96ND8

Popular ZNF583 Proteins

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Source: Human 293T Cells
Tag: Myc + DDK
Format: Purified / Lyophilized
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Source: Human 293T Cells
Tag: Myc + DDK
Format: Purified / Lyophilized
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Source: Human HEK 293 Cells
Tag: Myc + DDK
Format: Purified
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Source: Human HEK 293 Cells
Tag: Myc + DDK
Format: Purified

Publications (0)


Customer Reviews (0)


Images

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Requested From: United States
Date Requested: 9/19/2019