Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G90401-20 20 µg $130 
HGH1 / FAM203A Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Human HGH1 / FAM203A Protein (Over-Expression Lysate Myc-DDK (Flag)) (Full Length) - LS-G90401

Human HGH1 / FAM203A Protein (Over-Expression Lysate Myc-DDK (Flag)) (Full Length) - LS-G90401

Description:
HGH1 / FAM203A Protein LS-G90401 is an Over-Expression Lysate Human HGH1 / FAM203A with Myc-DDK (Flag) tag(s).
Price
Catalog Number
$130
LS-G90401-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
HGH1 / FAM203A Protein LS-G90401 is an Over-Expression Lysate Human HGH1 / FAM203A with Myc-DDK (Flag) tag(s).

Specifications

Type
Over-Expression Lysate Protein
Target
HGH1 / FAM203A
Synonyms
HGH1 | BRP16 | FAM203A | LOC51236 | Protein FAM203A | Brain protein 16 | C8orf30A
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
Myc-DDK (Flag)
Predicted Molecular Weight
41.9 kDa
AA Sequence
MGEAGAGAGASGGPEASPEAEVVKLLPFLAPGARADLQAAAVRHVLALTGCGPGRALLAGQAALLQALMELAPASAPARDAARALVNLAADPGLHETLLAADPGLPARLMGRALDPQWPWAEEAAAALANLSREPAPCAALMAALAAAEPADSGLERLVRALCTPGYNARAPLHYLAPLLSNLSQRPAARAFLLDPDRCVVQRLLPLTQYPDSSVRRGGVVGTLRNCCFEHRHHEWLLGPEVDILPFLLLPLAGPEDFSEEEMERLPVDLQYLPPDKQREPDADIRKMLVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGMENLLEVQVPEDVEQQLQQLDCREQEQLERELAPEPWVERATPT(CloningSiteandTags:myc-FLAG tag)
Expression System
293T Cells
Source Species
Human
Purification
Unpurified
Usage Summary
Intended for use as a Western blot control. Spin down briefly and resuspend in 2X SDS Sample Buffer (4% SDS, 125mM Tris-HCl pH6.8, 10% Glycerol, 0.002% Bromphenol blue, 100mM DTT). Prior to SDS-PAGE fractionation, boil the lysate for 5 minutes.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized. 25mM Tris-HCl, pH 7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProtein inhibitor cocktail mix, 1mM PMSF and 1mM NA3VO4
Reconstitution
Reconstitute with SDS Sample Buffer
Storage
Store at -20°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About HGH1 / FAM203A
Q9BTY7 NM_016458 NP_057542.2

Publications (0)

Customer Reviews (0)

Images

Western blot

HGH1 / FAM203A Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

HGH1 / FAM203A Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

HGH1 / FAM203A Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

HGH1 / FAM203A Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 1/21/2022