Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

Human ANKRD40 Protein (Recombinant Myc + DDK) (Full Length) - LS-G73161

Best Seller
Available for shipment within the USA only
Catalog
Size
Price
LS-G73161-20
20 µg
$890

Available for shipment within the USA only
Description
ANKRD40 Protein LS-G73161 is Recombinant Human ANKRD40 in Human with Myc + DDK tag(s).
Type
Recombinant Protein
Target
ANKRD40
Species
Human
Predicted Molecular Weight
40.9 kDa Full Length
Details
Purified Recombinant protein of human ankyrin repeat domain 40 (ANKRD40).
AA Sequence
MNALLEQKEQQERLREAAALGDIREVQKLVESGVDVNSQNEVNGWTCLHWACKRNHGQVVSYLLKSGADKEILTTKGEMPVQLTSRREIRKIMGVEEEDDDDDDDDNLPQLKKESELPFVPNYLANPAFPFIYTPTAEDSAQMQNGGPSTPPASPPADGSPPLLPPGEPPLLGTFPRDHTSLALVQNGDVSAPSAILRTPESTKPGPVCQPPVSQSRSLFSSVPSKPPMSLEPQNGTYAGPAPAFQPFFFTGAFPFNMQELVLKVRIQNPSLRENDFIEIELDRQELTYQELLRVCCCELGVNPDQVEKIRKLPNTLLRKDKDVARLQDFQELELVLMISENNFLFRNAASTLTERPCYNRRASKLTY(CloningSiteandTags:myc-FLAG tag)
Expression System
HEK 293 Cells
Source Species
Human
Tag
Myc + DDK
Purification
> 80% as determined by SDS-PAGE and Coomassie blue staining
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Available for shipment within the USA only.
About ANKRD40
Q6AI12 Q6AI12

Popular ANKRD40 Proteins

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Source: Human 293T Cells
Tag: Myc + DDK
Format: Purified / Lyophilized
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Source: Human HEK 293 Cells
Tag: Myc + DDK
Format: Purified

Publications (0)


Customer Reviews (0)


Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Purified recombinant protein ANKRD40 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein ANKRD40 was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Purified recombinant protein ANKRD40 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein ANKRD40 was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Purified recombinant protein ANKRD40 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein ANKRD40 was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Purified recombinant protein ANKRD40 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein ANKRD40 was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Requested From: United States
Date Requested: 9/15/2019