Products
Services
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G68841-20 20 µg $890 
MAGIX Protein - Purified recombinant protein MAGIX was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Human MAGIX Protein (Recombinant Myc-DDK (Flag)) (Full Length) - LS-G68841

Human MAGIX Protein (Recombinant Myc-DDK (Flag)) (Full Length) - LS-G68841

Available for shipment within the USA only
Description:
MAGIX Protein LS-G68841 is a Recombinant Human MAGIX produced in HEK 293 Cells with Myc-DDK (Flag) tag(s).
Price
Catalog Number
$890 
LS-G68841-20
20 µg

Available for shipment within the USA only
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
MAGIX Protein LS-G68841 is a Recombinant Human MAGIX produced in HEK 293 Cells with Myc-DDK (Flag) tag(s).

Specifications

Type
Recombinant Protein
Target
MAGIX
Synonyms
MAGIX | FLJ21687 | PDZ domain containing protein | MAGI family member, X-linked | JM10 | PDZX
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
Myc-DDK (Flag)
Predicted Molecular Weight
35 kDa
AA Sequence
MEPRTGGAANPKGSRGSRGPSPLAGPSARQLLARLDARPLAARAAVDVAALVRRAGATLRLRRKEAVSVLDSADIEVTDSRLPHATIVDHRPQHRWLETCNAPPQLIQGKARSAPKPSQASGHFSVELVRGYAGFGLTLGGGRDVAGDTPLAVRGLLKDGPAQRCGRLEVGDLVLHINGESTQGLTHAQAVERIRAGGPQLHLVIRRPLETHPGKPRGVGEPRKGVVPSWPDRSPDPGGPEVTGSRSSSTSLVQHPPSRTTLKKTRGSPEPSPEAAADGPTVSPPERRAEDPNDQIPGSPGPWLVPSEERLSRALGVRGAAQLAQEMAAGRRRH(CloningSiteandTags:myc-FLAG tag)
Expression System
HEK 293 Cells
Source Species
Human
Purification
> 80% as determined by SDS-PAGE and Coomassie blue staining
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Storage
Store at -80°C for up to 3 months. Avoid freeze/thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About MAGIX
Q9H6Y5 NM_024859 NP_079135.3

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAGIX Protein - Purified recombinant protein MAGIX was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein MAGIX was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAGIX Protein - Purified recombinant protein MAGIX was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein MAGIX was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAGIX Protein - Purified recombinant protein MAGIX was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein MAGIX was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAGIX Protein - Purified recombinant protein MAGIX was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein MAGIX was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Requested From: United States
Date Requested: 7/7/2020