LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

T4 Bacteriophage WAC Protein (Recombinant 6His + SUMO,N-terminus) (aa2-487) - LS-G57401

Best Seller
Catalog
Size
Price
LS-G57401-10
10 µg
$305
LS-G57401-50
50 µg
$375
LS-G57401-100
100 µg
$545
LS-G57401-200
200 µg
$890
LS-G57401-500
500 µg
$1,185
LS-G57401-1
1 mg (0.2 mg/ml)
$1,845
Description
WAC Protein LS-G57401 is Recombinant T4 Bacteriophage WAC aa 2-487 produced in E. coli with 6His + SUMO,N-terminus tag(s).
Type
Recombinant Protein
Target
WAC
Species
T4 Bacteriophage
Region
aa 2-487
AA Sequence
TDIVLNDLPFVDGPPAEGQSRISWIKNGEEILGADTQYGSEGSMNRPTVSVLRNVEVLDKNIGILKTSLETANSDIKTIQGILDVSGDIEALAQIGINKKDISDLKTLTSEHTEILNGTNNTVDSILADIGPFNAEANSVYRTIRNDLLWIKRELGQYTGQDINGLPVVGNPSSGMKHRIINNTDVITSQGIRLSELETKFIESDVGSLTIEVGNLREELGPKPPSFSQNVYSRLNEIDTKQTTVESDISAIKTSIGYPGNNSIITSVNTNTDNIASINLELNQSGGIKQRLTVIETSIGSDDIPSSIKGQIKDNTTSIESLNGIVGENTSSGLRANVSWLNQIVGTDSSGGQPSPPGSLLNRVSTIETSVSGLNNAVQNLQVEIGNNSAGIKGQVVALNTLVNGTNPNGSTVEERGLTNSIKANETNIASVTQEVNTAKGNISSLQGDVQALQEAGYIPEAPRDGQAYVRKDGEWVFLSTFLSPA
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Avoid freeze-thaw cycles. Store working aliquots at 4°C for up to 1 week. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 1 year at -20°C/-80°C.
Restrictions
For research use only.
About WAC
Q9BTA9 NM_016628 NP_057712.2

Popular WAC Proteins

12.5% SDS-PAGE of human WAC stained with Coomassie Blue
Source: Wheat Wheat Germ Extract
Tag: GST
Format: Purified
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Source: Human 293T Cells
Tag: Myc + DDK
Format: Purified / Lyophilized
Protein
Source: Human HEK 293 Cells
Tag: Myc + DDK
Format: Purified
Protein
Source: Human HEK 293 Cells
Tag: Myc + DDK
Format: Purified

Publications (0)


Customer Reviews (0)


Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Requested From: United States
Date Requested: 7/19/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy