Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G5731-10 10 µg $378 
LS-G5731-100 100 µg $1,350 
LS-G5731-500 500 µg $3,026 
LS-G5731-1 1 mg $3,786 
IL-10 Protein

Human IL-10 Protein (Recombinant) (aa19-178) - LS-G5731

Human IL-10 Protein (Recombinant) (aa19-178) - LS-G5731

Description:
IL-10 Protein LS-G5731 is a Recombinant Human IL-10 produced in E. coli aa 19-178. It is biologically active.
Price
Catalog Number
$378
LS-G5731-10
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
IL-10 Protein LS-G5731 is a Recombinant Human IL-10 produced in E. coli aa 19-178. It is biologically active.

Specifications

Type
Recombinant Protein
Target
IL-10
Synonyms
IL10 | CSIF | GVHDS | IL-10 | IL10A | Interleukin-10 | Interleukin 10 | TGIF
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Region
aa 19-178
Predicted Molecular Weight
18.6 kDa
AA Sequence
SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE and HPLC
Bio-Activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine MC/9-2 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 x 106 IU/mg.
Endotoxin
Not Tested
Presentation
Lyophilized from a 0.2µm filtered solution in PBS, pH7.4
Reconstitution
Briefly centrifuge vial prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration).
Storage
Short term: Store working aliquot at 4°C. Long term: Aliquot undiluted antibody and store at -20°C or -80°C for up to 1 year. Avoid freeze/thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL-10
P22301 NM_000572 NP_000563.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL-10 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL-10 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL-10 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL-10 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 1/19/2022