Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

Human PAK7/PAK5 Protein (Recombinant 6His,N-terminus) (aa1-293) - LS-G55986

Best Seller
Catalog
Size
Price
LS-G55986-10
10 µg (0.3 mg/ml)
$345
LS-G55986-20
20 µg
$455
LS-G55986-50
50 µg
$890
LS-G55986-100
100 µg
$1,230
LS-G55986-500
500 µg
$1,575
LS-G55986-1
1 mg
$2,205
Description
PAK7/PAK5 Protein LS-G55986 is Recombinant Human PAK7/PAK5 aa 1-293 produced in Insect with 6His,N-terminus tag(s).
Type
Recombinant Protein
Target
PAK7/PAK5
Species
Human
Region
aa 1-293
AA Sequence
MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ
Expression System
Baculovirus
Source Species
Insect
Tag
6His,N-terminus
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Avoid freeze-thaw cycles. Store working aliquots at 4°C for up to 1 week. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 1 year at -20°C/-80°C.
Restrictions
For research use only.
About PAK7/PAK5
Q9P286 NM_020341 NP_065074.1

Publications (0)


Customer Reviews (0)


Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Requested From: United States
Date Requested: 9/22/2019