Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G51898-10 10 µg $274 
LS-G51898-50 50 µg $421 
LS-G51898-500 500 µg $1,439 
LS-G51898-1 1 mg $2,055 
Protein

Mouse TREM1 Protein (Recombinant 6His, C-terminus) (Ala21-Ser202) - LS-G51898

Mouse TREM1 Protein (Recombinant 6His, C-terminus) (Ala21-Ser202) - LS-G51898

Description:
TREM1 Protein LS-G51898 is a Recombinant Mouse TREM1 produced in Human Cells Ala21-Ser202 with 6His, C-terminus tag(s). It is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method).
Price
Catalog Number
$274
LS-G51898-10
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
TREM1 Protein LS-G51898 is a Recombinant Mouse TREM1 produced in Human Cells Ala21-Ser202 with 6His, C-terminus tag(s). It is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method).

Specifications

Type
Recombinant Protein
Target
TREM1
Synonyms
TREM1 | CD354 | CD354 antigen | Triggering-receptor TREM1 | TREM-1
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, C-terminus
Region
Ala21-Ser202
Predicted Molecular Weight
20.9kD
AA Sequence
AIVLEEERYDLVEGQTLTVKCPFNIMKYANSQKAWQRLPDGKEPLTLVVTQRPFTRPSEVHMGKFTLKHDPSEAMLQVQMTDLQVTDSGLYRCVIYHPPNDPVVLFHPVRLVVTKGSSDVFTPVIIPITRLTERPILITTKYSPSDTTTTRSLPKPTAVVSSPGLGVTIINGTDADSVSTSSHHHHHH
Expression System
Human Cells
Source Species
Human
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from a sterile solution in PBS, pH 7.4.
Reconstitution
Reconstitute with ddH2O. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Minimum recommended concentration for storage is 100 µg/ml. Minimize freeze-thaw cycles.
Storage
Lyophilized protein should be stored at less than -20°C. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at less than -20°C for 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TREM1
Q9NP99 NM_018643 NP_061113.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 9/24/2021