Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G40304-10 10 µg $251 
LS-G40304-50 50 µg $350 
LS-G40304-500 500 µg $1,619 
LS-G40304-1 1 mg $2,428 
Protein

Cynomolgus monkey TNFSF4 / OX40L / CD252 Protein (Recombinant 8His, N-terminus) (Gln51-Leu183) - LS-G40304

Cynomolgus monkey TNFSF4 / OX40L / CD252 Protein (Recombinant 8His, N-terminus) (Gln51-Leu183) - LS-G40304

Description:
TNFSF4 / OX40L / CD252 Protein LS-G40304 is a Recombinant Cynomolgus monkey TNFSF4 / OX40L / CD252 produced in Human Cells Gln51-Leu183 with 8His, N-terminus tag(s). It is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method).
Price
Catalog Number
$251
LS-G40304-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
TNFSF4 / OX40L / CD252 Protein LS-G40304 is a Recombinant Cynomolgus monkey TNFSF4 / OX40L / CD252 produced in Human Cells Gln51-Leu183 with 8His, N-terminus tag(s). It is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method).

Specifications

Type
Recombinant Protein
Target
TNFSF4 / OX40L / CD252
Synonyms
TNFSF4 | CD134 ligand | CD134L | CD252 antigen | Glycoprotein Gp34 | OX-40L | OX40 ligand | TXGP1 | OX40L | OX4OL | CD252 | gp34 | OX40 antigen ligand
Species
Cynomolgus monkey
Modifications
Unmodified
Conjugations
Unconjugated
Tag
8His, N-terminus
Region
Gln51-Leu183
Predicted Molecular Weight
16.5kD
AA Sequence
HHHHHHHHQVSHQYPRIQSIKVQFTEYKKEEGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Expression System
Human Cells
Source Species
Human
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from a sterile solution in PBS, pH 7.4.
Reconstitution
Reconstitute with ddH2O. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Minimum recommended concentration for storage is 100 µg/ml. Minimize freeze-thaw cycles.
Storage
Lyophilized protein should be stored at less than -20°C. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at less than -20°C for 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TNFSF4 / OX40L / CD252
P23510 NM_003326 NP_003317.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 8/14/2022