Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G39894-10 10 µg $265 
LS-G39894-50 50 µg (1 mg/ml) $465 
LS-G39894-500 500 µg (1 mg/ml) $1,605 
LS-G39894-1 1 mg $2,520 
Protein

Human RNASET2 Protein (Recombinant 6His, C-terminus) (Asp25-His256) - LS-G39894

Human RNASET2 Protein (Recombinant 6His, C-terminus) (Asp25-His256) - LS-G39894

Description:
RNASET2 Protein LS-G39894 is a Recombinant Human RNASET2 Asp25-His256 produced in Human Cells with 6His, C-terminus tag(s). and is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method).
Price
Catalog Number
$265 
LS-G39894-10
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
RNASET2 Protein LS-G39894 is a Recombinant Human RNASET2 Asp25-His256 produced in Human Cells with 6His, C-terminus tag(s). and is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method).

Specifications

Type
Recombinant Protein
Target
RNASET2
Synonyms
RNASET2 | BA514O12.3 | Ribonuclease 6 | RNASE6PL | Ribonuclease T2 | RP11-514O12.3
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, C-terminus
Region
Asp25-His256
Predicted Molecular Weight
28.2kD
AA Sequence
DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHVDHHHHHH
Expression System
Human Cells
Source Species
Human
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Supplied as 0.2 µm filtered 20 mM Tris-HCl, pH 7.5, 150 mM NaCl, 20% Glycerol.
Storage
Store at less than -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About RNASET2
O00584 NM_003730 NP_003721.2

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 3/28/2020