LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human RNASET2 Protein (Recombinant 6His,C-terminus) (Asp25-His256) - LS-G39894

Best Seller
Catalog
Size
Price
LS-G39894-10
10 µg
$265
LS-G39894-50
50 µg (1 mg/ml)
$465
LS-G39894-500
500 µg (1 mg/ml)
$1,605
LS-G39894-1
1 mg
$2,520
Description
RNASET2 Protein LS-G39894 is Recombinant Human RNASET2 Asp25-His256 produced in Human with 6His,C-terminus tag(s). and is low in endotoxin Less than 1.0 EU/µg protein (determined by LAL method)..
Type
Recombinant Protein
Target
RNASET2
Species
Human
Predicted Molecular Weight
28.2kD
Details
Recombinant Human Ribonuclease T2 is produced by our Mammalian expression system and the target gene encoding Asp25-His256 is expressed with a 6His tag at the C-terminus.
Region
Asp25-His256
AA Sequence
DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHVDHHHHHH
Expression System
Human Cells
Source Species
Human
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Supplied as 0.2 µm filtered 20 mM Tris-HCl, pH 7.5, 150 mM NaCl, 20% Glycerol.
Storage
Store at less than -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Restrictions
For research use only.
About RNASET2
O00584 NM_003730 NP_003721.2

Popular RNASET2 Proteins

Recombinant Ribonuclease T2 By SDS-PAGE
Source: E. coli Expression System
Tag: His + GST
Format: Purified / Lyophilized
12.5% SDS-PAGE of human RNASET2 stained with Coomassie Blue
Source: Wheat Wheat Germ Extract
Tag: GST
Format: Purified
Protein
Source: E. coli Expression System
Tag: GST,N-terminus
Purified recombinant protein RNASET2 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Source: Human HEK 293 Cells
Tag: Myc + DDK
Format: Purified

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 7/19/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy