Products
Services
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G27106-10 10 µg $235 
LS-G27106-50 50 µg $395 
LS-G27106-1 1 mg $2,670 
Protein

Mouse OSM / Oncostatin M Protein (Recombinant) - LS-G27106

Mouse OSM / Oncostatin M Protein (Recombinant) - LS-G27106

Description:
OSM / Oncostatin M Protein LS-G27106 is a Recombinant Mouse OSM / Oncostatin M produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.2 EU/µg protein (determined by LAL method).
Price
Catalog Number
$235
LS-G27106-10
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
OSM / Oncostatin M Protein LS-G27106 is a Recombinant Mouse OSM / Oncostatin M produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.2 EU/µg protein (determined by LAL method).

Specifications

Type
Recombinant Protein
Target
OSM / Oncostatin M
Synonyms
OSM | Oncostatin-M | Oncostatin M
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Predicted Molecular Weight
20.5 kDa (SDS-PAGE)
AA Sequence
MNRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSR
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE and HPLC
Bio-Activity
ED50 < 10 ng/mL, as determined by a cell proliferation assay using Rat Embryo Brain cells, corresponding to a specific activity of > 1x 10^5 units/mg.
Endotoxin
Less than 0.2 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from PBS
Reconstitution
Reconstitute in ddH2O or PBS at 100 µg/ml.
Storage
Stable at -80°c for up to 6 months. Upon reconstitution, store at 4°c for up to 2 weeks or at -20°c for up to 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About OSM / Oncostatin M
P13725 NM_020530 NP_065391.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/26/2020