Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G22960-20 20 µg $326 
LS-G22960-100 100 µg (0.5 mg/ml) $436 
LS-G22960-1 1 mg $1,342 
ICA69 / ICA1 Protein

Human ICA69 / ICA1 Protein (Recombinant His) (aa1-268) - LS-G22960

Human ICA69 / ICA1 Protein (Recombinant His) (aa1-268) - LS-G22960

Description:
ICA69 / ICA1 Protein LS-G22960 is a Recombinant Human ICA69 / ICA1 produced in Yeast aa 1-268 with His tag(s).
Price
Catalog Number
$326
LS-G22960-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
ICA69 / ICA1 Protein LS-G22960 is a Recombinant Human ICA69 / ICA1 produced in Yeast aa 1-268 with His tag(s).

Specifications

Type
Recombinant Protein
Target
ICA69 / ICA1
Synonyms
ICA1 | 69 kDa islet cell autoantigen | ICA69 | Islet cell autoantigen 1 | p69 | Islet cell autoantigen p69 | ICAp69
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Region
aa 1-268
Predicted Molecular Weight
33.5 kD
AA Sequence
MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK
Expression System
Yeast
Source Species
Yeast
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20mM Tris-HCl, 0.5M NaCl, pH 8.0 and 50% glycerol.
Storage
Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About ICA69 / ICA1
Q05084 NM_004968 NP_004959.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ICA69 / ICA1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ICA69 / ICA1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ICA69 / ICA1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ICA69 / ICA1 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 8/14/2022