Products
Services
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G22712-20 20 µg $265 
LS-G22712-100 100 µg $355 
LS-G22712-1 1 mg (0.24 mg/ml) $1,290 
LOX / Lysyl Oxidase Protein

Human LOX / Lysyl Oxidase Protein (Recombinant 6His, N-terminus) (aa174-417) - LS-G22712

Human LOX / Lysyl Oxidase Protein (Recombinant 6His, N-terminus) (aa174-417) - LS-G22712

Description:
LOX / Lysyl Oxidase Protein LS-G22712 is a Recombinant Human LOX / Lysyl Oxidase produced in E. coli aa 174-417 with 6His, N-terminus tag(s).
Price
Catalog Number
$265 
LS-G22712-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
LOX / Lysyl Oxidase Protein LS-G22712 is a Recombinant Human LOX / Lysyl Oxidase produced in E. coli aa 174-417 with 6His, N-terminus tag(s).

Specifications

Type
Recombinant Protein
Target
LOX / Lysyl Oxidase
Synonyms
LOX | Lysyl oxidase | Protein-lysine 6-oxidase
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus
Region
aa 174-417
Predicted Molecular Weight
32.5 kD
AA Sequence
PYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About LOX / Lysyl Oxidase
P28300 NM_002317 NP_002308.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

LOX / Lysyl Oxidase Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

LOX / Lysyl Oxidase Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

LOX / Lysyl Oxidase Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

LOX / Lysyl Oxidase Protein

Requested From: United States
Date Requested: 7/11/2020