Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G20699-20 20 µg $265 
LS-G20699-100 100 µg $355 
LS-G20699-1 1 mg $1,290 
EIF5 Protein

Human EIF5 Protein (Recombinant His-SUMO) (Full Length) - LS-G20699

Human EIF5 Protein (Recombinant His-SUMO) (Full Length) - LS-G20699

Description:
EIF5 Protein LS-G20699 is a Recombinant Human EIF5 aa 1-431 produced in E. coli with His-SUMO tag(s).
Price
Catalog Number
$265 
LS-G20699-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
EIF5 Protein LS-G20699 is a Recombinant Human EIF5 aa 1-431 produced in E. coli with His-SUMO tag(s).

Specifications

Type
Recombinant Protein
Target
EIF5
Synonyms
EIF5 | EIF-5A | EIF-5
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His-SUMO
Region
aa 1-431
Predicted Molecular Weight
65.2 kD
AA Sequence
MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAKRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About EIF5
P55010 NM_001969 NP_001960.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EIF5 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EIF5 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EIF5 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EIF5 Protein

Requested From: United States
Date Requested: 4/1/2020