Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G18780-1 1 µg $195 
LS-G18780-5 5 µg $255 
LS-G18780-50 50 µg $1,260 
Protein

Human OVCA2 Protein (Recombinant His) - LS-G18780

Human OVCA2 Protein (Recombinant His) - LS-G18780

Description:
OVCA2 Protein LS-G18780 is a Recombinant Human OVCA2 produced in E. coli with His tag(s).
Price
Catalog Number
$195 
LS-G18780-1
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
OVCA2 Protein LS-G18780 is a Recombinant Human OVCA2 produced in E. coli with His tag(s).

Specifications

Type
Recombinant Protein
Target
OVCA2
Synonyms
OVCA2 | Ovarian cancer gene-2 protein
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Predicted Molecular Weight
26.9 kDa
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSDFGSCPPEEQPRGWWFSEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAE
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 0.1 M NaCl, 1 mM DTT, 10% Glycerol
Storage
Store at 4°C short term. Store at -20°C long term. Carrier protein recommended for long term storage or low concentration. Avoid multiple freeze-thaw cycles
Restrictions
For research use only.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About OVCA2
Q8WZ82 Q8WZ82

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 4/5/2020