Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

Human OVCA2 Protein (Recombinant His) - LS-G18780

Catalog
Size
Price
LS-G18780-1
1 µg
$195
LS-G18780-5
5 µg
$255
LS-G18780-50
50 µg
$1,260
Description
OVCA2 Protein LS-G18780 is Recombinant Human OVCA2 in E. coli with His tag(s).
Type
Recombinant Protein
Target
OVCA2
Species
Human
Predicted Molecular Weight
26.9 kDa
Details
OVCA2 Human Recombinant produced in E. coli is a single polypeptide chain containing 251 amino acids (1-227) and having a molecular mass of 26.9kDa.OVCA2 is fused to a 23 amino acid His-tag at N-terminus and purified by proprietary chromatographic techniques.
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSDFGSCPPEEQPRGWWFSEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAE
Expression System
E. coli
Source Species
E. coli
Tag
His
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 0.1 M NaCl, 1 mM DTT, 10% Glycerol
Storage
Store at 4°C short term. Store at -20°C long term. Carrier protein recommended for long term storage or low concentration. Avoid multiple freeze-thaw cycles
Restrictions
For research use only.
About OVCA2
Q8WZ82 Q8WZ82

Popular OVCA2 Proteins

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
Tag: His
Format: Purified
12.5% SDS-PAGE of human OVCA2 stained with Coomassie Blue
Source: Wheat Wheat Germ Extract
Tag: GST
Format: Purified
Purified recombinant protein OVCA2 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Source: Human HEK 293 Cells
Tag: Myc + DDK
Format: Purified
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Source: Human 293T Cells
Tag: Myc + DDK
Format: Purified / Lyophilized

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 9/17/2019