Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

KRT74 / Keratin 74 Protein (Over-Expression Lysate Myc + DDK) (Full Length) - LS-G105119

Available for shipment within the USA only
Catalog
Size
Price
LS-G105119-100
100 µg
$485

Available for shipment within the USA only
Description
KRT74 / Keratin 74 Protein LS-G105119 is Over-Expression Lysate KRT74 / Keratin 74 in Human with Myc + DDK tag(s).
Type
Over-Expression Lysate Protein
Target
KRT74 / Keratin 74
Predicted Molecular Weight
57.7 kDa Full Length
Details
This product includes lysate of HEK293T cells that have been transiently-tranfected with Human KRT74 (NM_175053), cells transfected with the vector alone, and a reducing buffer for SDS-Page gel loading. Cells were lysed using Modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix and 1mM Na3VO4).
AA Sequence
MSRQLNIKSSGDKGNFSVHSAVVPRKAVGSLASYCAAGRGAGAGFGSRSLYSLGGNRRISFNVAGGGVRAGGYGFRPGSGYGGGRASGFAGSMFGSVALGPACLSVCPPGGIHQVTVNKSLLAPLNVELDPEIQKVRAQEREQIKVLNDKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKKNLEPILEGYISNLRKQLETLSGDRVRLDSELRSMRDLVEDYKKRYEVEINRRTTAENEFVVLKKDADAAYAVKVELQAKVDSLDKEIKFLKCLYDAEIAQIQTHASETSVILSMDNNRDLDLDSIIAEVRMHYEEIALKSKAEAEALYQTKIQELQLAASRHGDDLKHTRSEMVELNRLIQRIRCEIGNVKKQRASLETAIADAEQRGDNALKDAQAKLDELEGALHQAKEELARMLREYQELMSLKLALDMEIATYRKLLEGEECRMSGENPSSVSISVISSSSYSYHHPSSAGVDLGASAVAGSSGSTQSGQTKTTEARGGDLKDTQGKSTPASIPARKATR(CloningSiteandTags:myc-FLAG tag)
Expression System
HEK 293 Cells
Source Species
Human
Tag
Myc + DDK
Purification
Unpurified
Bio-Activity
Not Tested
Endotoxin
Not Tested
Storage
Store at -20°C for up to 1 year. Avoid freeze-thaw cycles.
Usage Summary
Western blot: Spin down briefly and dilute with 2xSDS Sample Buffer provided (4% SDS, 125mM Tris-HCl pH6.8, 10% Glycerol, 0.002% Bromphenol blue, 100mM DTT). Prior to SDS-PAGE fractionation, boil the lysate for 5 minutes.
Restrictions
For research use only. Available for shipment within the USA only.
About KRT74 / Keratin 74
Q7RTS7 NP_778223.2

Popular KRT74 / Keratin 74 Proteins

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Source: Human 293T Cells
Tag: Myc + DDK
Format: Purified / Lyophilized

Publications (0)


Customer Reviews (0)


Images

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Requested From: United States
Date Requested: 9/16/2019