Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G56230-20 20 µg $395 
LS-G56230-100 100 µg $565 
LS-G56230-1 1 mg $1,646 
tmk / Thymidylate Kinase Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mycobacterium tuberculosis tmk / Thymidylate Kinase Protein (Recombinant 6His-SUMO, N-terminus) (aa1-214) - LS-G56230

Mycobacterium tuberculosis tmk / Thymidylate Kinase Protein (Recombinant 6His-SUMO, N-terminus) (aa1-214) - LS-G56230

Description:
tmk / Thymidylate Kinase Protein LS-G56230 is a Recombinant Mycobacterium tuberculosis tmk / Thymidylate Kinase produced in E. coli aa 1-214 with 6His-SUMO, N-terminus tag(s).
Price
Catalog Number
$395
LS-G56230-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
tmk / Thymidylate Kinase Protein LS-G56230 is a Recombinant Mycobacterium tuberculosis tmk / Thymidylate Kinase produced in E. coli aa 1-214 with 6His-SUMO, N-terminus tag(s).

Specifications

Type
Recombinant Protein
Target
tmk / Thymidylate Kinase
Synonyms
tmk
Species
Mycobacterium tuberculosis
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His-SUMO, N-terminus
Region
aa 1-214
AA Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Avoid freeze-thaw cycles. Store working aliquots at 4°C for up to 1 week. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 1 year at -20°C/-80°C.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About tmk / Thymidylate Kinase
NP_842597.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

tmk / Thymidylate Kinase Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

tmk / Thymidylate Kinase Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

tmk / Thymidylate Kinase Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

tmk / Thymidylate Kinase Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/15/2021