Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136746-10 10 µg $313 
LS-G136746-50 50 µg $516 
TNF Alpha Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mouse TNF Alpha Protein (Recombinant) - LS-G136746

Mouse TNF Alpha Protein (Recombinant) - LS-G136746

Description:
TNF Alpha Protein LS-G136746 is a Recombinant Mouse TNF Alpha produced in E. coli 89-235aa. It is biologically active and is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method). For Research Use Only
Price
Catalog Number
$313
LS-G136746-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
TNF Alpha Protein LS-G136746 is a Recombinant Mouse TNF Alpha produced in E. coli 89-235aa. It is biologically active and is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method). For Research Use Only

Specifications

Type
Recombinant Protein
Target
TNF Alpha
Synonyms
TNF | APC1 protein | Cachectin | DIF | TNF Alpha | Tumor necrosis factor-alpha | TNF-alpha | TNF-a | TNFA | Tumor necrosis factor | TNF, macrophage-derived | TNF, monocyte-derived | TNFSF2
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Region
89-235aa
Predicted Molecular Weight
16.4 kDa
AA Sequence
DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE
Usage Summary
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.; FUNCTION
Bio-Activity
The ED50 as determined in a cytotoxicity assay using L-929 mouse fibroblast cells is less than 0.08 ng/ml in the presence of the metabolic inhibitor actinomycin D.
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from 0.2 µm filtered PBS, pH 7.4
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TNF Alpha
P01375 NM_000594 NP_000585.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TNF Alpha Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TNF Alpha Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TNF Alpha Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TNF Alpha Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/9/2023