LSBio
Products
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Immunohistochemistry Reagents
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
Services
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question? CustomerSupport@LSBio.com
Research Areas
  • Cancer Research:
  • Breast Cancer IHC
  • Colorectal Cancer IHC
  • Lung Cancer IHC
  • Prostate Cancer IHC
  • Cell Cycle:
  • Apoptosis
  • Protein Family and Group:
  • Caspases
  • Chemokines
Resources
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Reviews
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Distributors
Contact Us

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Mouse PLXDC2 Protein (Recombinant 6His,C-terminus) (Glu31-Ala455) - LS-G39190

Catalog Size Price
LS-G39190-10 10 µg Unavailable
LS-G39190-50 50 µg Unavailable
LS-G39190-500 500 µg Unavailable
LS-G39190-1000 1000 µg Unavailable

Most Popular PLXDC2 Proteins

Human PLXDC2 Protein (Recombinant GST) (Full Length) - LS-G35852
Wheat Wheat Germ Extract
480 AA
GST
Purified
12.5% SDS-PAGE of human PLXDC2 stained with Coomassie Blue
Mouse PLXDC2 Protein (Recombinant 6His,C-terminus) (Glu31-Ala455) - LS-G39190
Human Human Cells
433 AA
6His,C-terminus
Purified / Lyophilized / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Human PLXDC2 Protein (Recombinant GST,N-terminus) (aa29-108) - LS-G63414
Wheat Wheat Germ Extract
80 AA
GST,N-terminus
12.5% SDS-PAGE Stained with Coomassie Blue.
Human PLXDC2 Protein (Recombinant Myc + DDK) - LS-G68891
Human HEK 293 Cells
584 AA
Myc + DDK
Purified
Purified recombinant protein PLXDC2 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Human PLXDC2 Protein (Over-Expression Lysate Myc + DDK) - LS-G83326
Human 293T Cells
584 AA
Myc + DDK
Purified / Lyophilized
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

100% Guaranteed
LS-G39190
Recombinant Protein
PLXDC2
Mouse
48.95kD
Recombinant Mouse PLXDC2 is produced by our Mammalian expression system and the target gene encoding Glu31-Ala455 is expressed with a 6His tag at the C-terminus.
Glu31-Ala455
EPGHHTNDWIYEVTNAFPWNEEGVEVDSQAYNHRWKRNVDPFKAVDTNRASMGQASPESKGFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPADSASRDLWVNIDQMEKDKVKIHGILSNTHRQAARVNLSFDFPFYGHFLNEVTVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVHLQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQIPNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNGCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEEVQSKEKMCEKTEPGETSQTTTTSHTTTMQFRVLTTTRRAVTSQMPTSLPTEDDTKIALHLKDSGASTDDSAAEKKGGTLHAVDHHHHHH
Human Cells
Human
6His,C-terminus
Greater than 95% by SDS-PAGE
Not Tested
Less than 1.0 EU/µg protein (determined by LAL method).
Lyophilized from 0.2 µm filtered PBS, pH 7.4.
Lyophilized protein should be stored at less than -20°C. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at less than -20°C for 3 months.
For research use only.

About PLXDC2

Q6UX71 NM_032812 NP_116201.7

PLXDC2 Protein, Plexin domain containing 2 Protein, TEM7R Protein

May play a role in tumor angiogenesis.

Requested From: 
Date Requested: 6/20/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number