Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G16995-5 5 µg $195 
LS-G16995-20 20 µg $255 
LS-G16995-1 1 mg $2,850 
Protein

Mouse NGF Protein (Recombinant) - LS-G16995

Mouse NGF Protein (Recombinant) - LS-G16995

Description:
NGF Protein LS-G16995 is Recombinant Mouse NGF in E. coli It is biologically active
Price
Catalog Number
$195 
LS-G16995-5
Toll Free North America
866-819-4732

Overview

Description:
NGF Protein LS-G16995 is Recombinant Mouse NGF in E. coli It is biologically active

Specifications

Type
Recombinant Protein
Target
NGF
Species
Mouse
Modifications
Unmodified
Predicted Molecular Weight
13.471 kDa
AA Sequence
MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 98% by SDS-PAGE and RP-HPLC
Bio-Activity
The Mouse b-NGF activity was measured in a cell proliferation assay using a factor-dependent human erythroleukemic cell line, TF-1, the ED50 for this effect is 0.2 ng/ml, corresponding to a Specific Activity of 5,000,000 units/mg.
Endotoxin
Not Tested
Presentation
Lyophilized without additives.
Storage
Store at -20°C. Store at 4°C after reconstitution between 2-7 days. Avoid multiple freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About NGF
P01138 NM_002506 NP_002497.2

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 12/14/2019