LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Mouse IL7 Protein (Recombinant) - LS-G134063

Catalog
Size
Price
LS-G134063-2
2 µg
$205
LS-G134063-10
10 µg
$285
LS-G134063-100
100 µg
$710
LS-G134063-500
500 µg
$3,555
LS-G134063-1
1 mg
$5,940
Description
IL7 Protein LS-G134063 is Recombinant Mouse IL7 in E. coli It is biologically active and is low in endotoxin Less than 1.0 EU/µg protein (determined by LAL method)..
Type
Animal-Free  Recombinant Protein
Target
IL7
Species
Mouse
Predicted Molecular Weight
15 kDa
Details
Interleukin 7 (IL-7) is a hematopoietic cytokine that is an important regulator of B and T cell development. IL-7 is secreted by bone marrow and thymic stromal cells, dendritic cells, intestinal epithelial cells, hepatocytes, and keratinocytes. IL-7 signals through the interleukin 7 receptor (IL-7R) to promote the differentiation of hematopoietic stem cells into T cells, B cells, and natural killer cells. IL-7 is also a regulator of intestinal mucosal lymphocyte proliferation. Human and mouse IL-7 show species cross-reactivity.
AA Sequence
MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by reducing and non-reducing SDS-PAGE
Bio-Activity
Determined by 2E8 Cell Proliferation; <= 1 ng/ml; >= 1.0x10^6 units/mg
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from 10 mM Acetic Acid
Reconstitution
Centrifuge vial before opening. Reconstitute with sterile water at 0.1 mg/mL. Suspend the product by gently pipetting the recommended solution down the sides of the vial. Do not vortex. Allow several minutes for complete reconstitution.
Storage
Shipped at room temperature. Prior to reconstitution, store at -20°C. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution. Store at -80°C and avoid freeze-thaw cycles.
Restrictions
For research use only.
About IL7
P13232 NM_000880 NP_000871.1

Popular IL7 Proteins

Protein
Source: Hamster-Chinese CHO Cells
Tag: Human mutant IgG1 Fc
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.06 EU/µg protein (determined by LAL method).
Protein
Source: Human Human Cells
Tag: 6His,C-terminus
Format: Purified / Lyophilized / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).

Publications (0)


Customer Reviews (0)


Images

Assay Result

Mouse IL-7 Bioassay: Proliferation of 2E8 cells
Mouse IL-7 Bioassay: Proliferation of 2E8 cells

Western blot

Assay Result

Mouse IL-7 Bioassay: Proliferation of 2E8 cells
Mouse IL-7 Bioassay: Proliferation of 2E8 cells

Western blot

Assay Result

Mouse IL-7 Bioassay: Proliferation of 2E8 cells
Mouse IL-7 Bioassay: Proliferation of 2E8 cells

Western blot

Assay Result

Mouse IL-7 Bioassay: Proliferation of 2E8 cells
Mouse IL-7 Bioassay: Proliferation of 2E8 cells

Western blot


Requested From: United States
Date Requested: 7/18/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy