LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Mouse IL11 Protein (Recombinant) - LS-G23743

Catalog
Size
Price
LS-G23743-2
2 µg
$205
LS-G23743-10
10 µg
$285
LS-G23743-100
100 µg
$710
LS-G23743-500
500 µg
$3,555
LS-G23743-1
1 mg
$5,940
Description
IL11 Protein LS-G23743 is Recombinant Mouse IL11 in E. coli It is biologically active and is low in endotoxin Less than 1.0 EU/µg protein (determined by LAL method)..
Type
Animal-Free  Recombinant Protein
Target
IL11
Species
Mouse
Predicted Molecular Weight
19.3 kDa
Details
Interleukin 11 (IL-11) is a member of the gp130 family of cytokines. IL-11 functions to promote hematopoietic stem cell proliferation and megakaryocyte differentiation. In non-hematopoietic cell populations, IL-11 stimulates acute-phase proteins, modulates the development of immunoglobulin-producing B cells, and regulates bone turnover. IL-11 binds the IL-11Ralpha (IL-11Ra) receptor to activate JAK downstream signaling. This product is produced with no animal or human origin raw products. All processing and handling employs animal free equipment and animal free protocols.
AA Sequence
MPGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Tested using: B9 cell proliferation. ED50 less than or equal to 250 ng/mL (greater than or equal to 4.0 x 10^3 units/mg). In addition to the acceptance criteria, this product has been tested with the following assay: T-11 proliferation (ED50 less than or equal to 2.5 ng/mL and greater than or equal to 4.0 x 10^5 units/mg).
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution
Reconstitute in sterile water to 0.1 mg/ml
Storage
Store at -20°C to -80°C for up to 1 year. Store at 4°C for up to 1 month or up to 3 months at -20°C to -80°C after reconstitution.
Restrictions
For research use only.
About IL11
P20809 NM_000641 NP_000632.1

Popular IL11 Proteins

Protein
Source: Hamster-Chinese CHO Cells
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.2 EU/µg protein (determined by LAL method).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Animal-Free / Endotoxin Level: Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).

Publications (0)


Customer Reviews (0)


Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis


Requested From: United States
Date Requested: 3/26/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy