Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G23743-2 2 µg $215 
LS-G23743-10 10 µg $285 
LS-G23743-100 100 µg $755 
LS-G23743-500 500 µg $3,735 
LS-G23743-1 1 mg $6,225 
IL11 Protein

Mouse IL11 Protein (Recombinant) - LS-G23743

Mouse IL11 Protein (Recombinant) - LS-G23743

Description:
IL11 Protein LS-G23743 is Recombinant Mouse IL11 in E. coli It is biologically active and is low in endotoxin Less than 1.0 EU/µg protein (determined by LAL method)..
Price
Catalog Number
$215 
LS-G23743-2
Toll Free North America
866-819-4732

Overview

Description:
IL11 Protein LS-G23743 is Recombinant Mouse IL11 in E. coli It is biologically active and is low in endotoxin Less than 1.0 EU/µg protein (determined by LAL method)..

Specifications

Type
Recombinant Protein
Target
IL11
Synonyms
IL11 | AGIF | Adipogenesis inhibitory factor | IL-11 | Interleukin-11 | Interleukin 11
Species
Mouse
Modifications
Animal-free
Conjugations
Unconjugated
Predicted Molecular Weight
19.3 kDa
AA Sequence
MPGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Tested using: B9 cell proliferation. ED50 less than or equal to 250 ng/mL (greater than or equal to 4.0 x 10^3 units/mg). In addition to the acceptance criteria, this product has been tested with the following assay: T-11 proliferation (ED50 less than or equal to 2.5 ng/mL and greater than or equal to 4.0 x 10^5 units/mg).
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution
Reconstitute in sterile water to 0.1 mg/ml
Storage
Store at -20°C to -80°C for up to 1 year. Store at 4°C for up to 1 month or up to 3 months at -20°C to -80°C after reconstitution.
Restrictions
For research use only.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL11
P20809 NM_000641 NP_000632.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL11 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL11 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL11 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL11 Protein

Requested From: United States
Date Requested: 2/17/2020