Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G16442-5 5 µg $195 
LS-G16442-20 20 µg $255 
LS-G16442-1 1 mg $2,850 
Protein

Mouse CXCL11 Protein (Recombinant) - LS-G16442

Mouse CXCL11 Protein (Recombinant) - LS-G16442

Description:
CXCL11 Protein LS-G16442 is Recombinant Mouse CXCL11 in E. coli It is biologically active
Price
Catalog Number
$195 
LS-G16442-5
Toll Free North America
866-819-4732

Overview

Description:
CXCL11 Protein LS-G16442 is Recombinant Mouse CXCL11 in E. coli It is biologically active

Specifications

Type
Recombinant Protein
Target
CXCL11
Species
Mouse
Modifications
Unmodified
AA Sequence
FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 98% by SDS-PAGE and RP-HPLC
Bio-Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using murine CXCR3 transfected 293 cells is in a concentration of 10-100 ng/ml corresponding to a specific activity of 10,000-100,000 IU/mg.
Endotoxin
Not Tested
Presentation
10 mM Sodium Citrate, pH 4.0, 0.6 M NaCl
Storage
Store at -20°C. Store at 4°C after reconstitution between 2-7 days. Carrier protein recommended for long term storage or low concentration. Avoid multiple freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About CXCL11
O14625 NM_005409 NP_005400.1

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 12/10/2019