LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Mouse CSF1 / MCSF Protein (Recombinant) - LS-G23682

Catalog
Size
Price
LS-G23682-2
2 µg
$205
LS-G23682-10
10 µg
$285
LS-G23682-100
100 µg
$605
LS-G23682-500
500 µg
$2,895
LS-G23682-1
1 mg
$4,815
Description
CSF1 / MCSF Protein LS-G23682 is Recombinant Mouse CSF1 / MCSF in E. coli It is biologically active and is low in endotoxin Less than 1.0 EU/µg protein (determined by LAL method)..
Type
Animal-Free  Recombinant Protein
Target
CSF1 / MCSF
Species
Mouse
Predicted Molecular Weight
36.4 kDa
Details
Macrophage Colony Stimulating Factor comes as a dimer having a 156/312 amino acid chain. Macrophage colony stimulating factor (M-CSF) is a hematopoietic growth factor that is widely produced by a variety of cells. M-CSF stimulates the proliferation and differentiation of hematopoietic stem cells into monocyte and macrophage cell types. M-CSF also acts through the colony stimulating factor 1 receptor (CSF1R) to modulate processes involved in immunology, bone metabolism, fertility, and pregnancy. Human M-CSF shows activity on mouse cells; however, mouse CSF shows no activity on human cells. This product is produced with no animal or human origin raw products. All processing and handling employs animal free equipment and animal free protocols.
AA Sequence
MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Tested using: NFS-60 cell proliferation. Less than or equal to 10 ng/mL and greater than or equal to 1.0 x 10^5 units/mg.
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
Reconstitution
Reconstitute in sterile water to 0.1 mg/ml
Storage
Store at -20°C to -80°C for up to 1 year. Store at 4°C for up to 1 month or up to 3 months at -20°C to -80°C after reconstitution.
Restrictions
For research use only.
About CSF1 / MCSF
P09603 NM_000757 NP_000748.3

Popular CSF1 / MCSF Proteins

Biological Activity M-CSF, Human stimulates cell proliferation of M-NFS-60 cells. The ED 50 for this effect is less than 5ng/mL.
Source: Hamster-Chinese CHO Cells
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.2 EU/µg protein (determined by LAL method).
Protein
Source: Hamster-Chinese CHO Cells
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.2 EU/µg protein (determined by LAL method).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Animal-Free / Endotoxin Level: Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).

Publications (0)


Customer Reviews (0)


Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis


Requested From: United States
Date Requested: 3/26/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy