Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G4969-10 10 µg $412 
LS-G4969-50 50 µg $991 
Protein

Human UPK3A / UPK3 / Uroplakin III Protein (Recombinant His) - LS-G4969

Human UPK3A / UPK3 / Uroplakin III Protein (Recombinant His) - LS-G4969

Description:
UPK3A / UPK3 / Uroplakin III Protein LS-G4969 is a Recombinant Human UPK3A / UPK3 / Uroplakin III produced in E. coli with His tag(s).
Price
Catalog Number
$412
LS-G4969-10
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
UPK3A / UPK3 / Uroplakin III Protein LS-G4969 is a Recombinant Human UPK3A / UPK3 / Uroplakin III produced in E. coli with His tag(s).

Specifications

Type
Recombinant Protein
Target
UPK3A / UPK3 / Uroplakin III
Synonyms
UPK3A | Uroplakin 3 | Uroplakin 3A | Uroplakin III | UPIII | UP3A | UPIIIA | UPK3 | Uroplakin-3a
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Predicted Molecular Weight
23.1 kDa
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSAISRNASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANGTCLWDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGG
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Sterile filtered 20 mM Tris-HCl, pH 8.0, 150 mM NaCl, 2 mM DTT, 20% glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About UPK3A / UPK3 / Uroplakin III
O75631 NM_006953 NP_008884.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/19/2021