Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G5118-100 100 µg $425 
TREM1 Protein

Human TREM1 Protein (Recombinant His) - LS-G5118

Human TREM1 Protein (Recombinant His) - LS-G5118

Available for shipment within the USA only
Description:
TREM1 Protein LS-G5118 is a Recombinant Human TREM1 produced in E. coli with His tag(s). It is low in endotoxin; Less than 1.0 EU/µg protein.
Price
Catalog Number
$425
LS-G5118-100

Available for USA Shipment Only
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
TREM1 Protein LS-G5118 is a Recombinant Human TREM1 produced in E. coli with His tag(s). It is low in endotoxin; Less than 1.0 EU/µg protein.

Specifications

Type
Recombinant Protein
Target
TREM1
Synonyms
TREM1 | CD354 | CD354 antigen | Triggering-receptor TREM1 | TREM-1
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Predicted Molecular Weight
23.3 kDa
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFN
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Less than 1.0 EU/µg protein.
Presentation
20 mM Tris-HCl, pH 8.0, 0.15 M NaCl, 1 mM DTT, 30% Glycerol
Storage
Store at -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TREM1
Q9NP99 NM_018643 NP_061113.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TREM1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TREM1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TREM1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TREM1 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/28/2021