Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G4919-10 10 µg $295 
LS-G4919-50 50 µg $493 
Protein

Human TMPRSS15 / Enterokinase Protein (Recombinant) - LS-G4919

Human TMPRSS15 / Enterokinase Protein (Recombinant) - LS-G4919

Description:
TMPRSS15 / Enterokinase Protein LS-G4919 is a Recombinant Human TMPRSS15 / Enterokinase produced in CHO Cells. It is low in endotoxin; Less than 0.2 ng/µg of protein (less than 2EU/µg).
Price
Catalog Number
$295
LS-G4919-10
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
TMPRSS15 / Enterokinase Protein LS-G4919 is a Recombinant Human TMPRSS15 / Enterokinase produced in CHO Cells. It is low in endotoxin; Less than 0.2 ng/µg of protein (less than 2EU/µg).

Specifications

Type
Recombinant Protein
Target
TMPRSS15 / Enterokinase
Synonyms
TMPRSS15 | Enteropeptidase | Enterokinase | ENTK | PRSS7 | Serine protease 7
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Predicted Molecular Weight
97.5 kDa
AA Sequence
Heavychain:LTIKESQRGAALGQSHEARATFKITSGVTYNPNLQDKLSVDFKVLAFDLQQMIDEIFLSSNLKNEYKNSRVLQFENGSIIVVFDLFFAQWVSDQNVKEELIQGLEANKSSQLVTFHIDLNSVDILDKLTTTSHLATPGNVSIECLPGSSPCTDALTCIKADLFCDGEVNCPDGSDEDNKMCATVCDGRFLLTGSSGSFQATHYPKPSETSVVCQWIIRVN
Expression System
CHO Cells
Source Species
Hamster-Chinese
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Sequentially cleaves carboxyl side of D-D-D-D-K.
Endotoxin
Less than 0.2 ng/µg of protein (less than 2EU/µg).
Presentation
Lyophilized from 10 mM sodium phosphate, pH 7.5, 1 mM Calcium Chloride
Reconstitution
Centrifuge the vial before opening. Reconstitute in water to 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week.
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TMPRSS15 / Enterokinase
P98073 NM_002772 NP_002763.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/15/2021