LSBio
Products
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Immunohistochemistry Reagents
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
Services
  • Immunohistochemistry Services

    • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

    • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question? CustomerSupport@LSBio.com
Research Areas
  • Cancer Research:
  • Breast Cancer IHC
  • Colorectal Cancer IHC
  • Lung Cancer IHC
  • Prostate Cancer IHC
  • Cell Cycle:
  • Apoptosis
  • Protein Family and Group:
  • Caspases
  • Chemokines
Resources
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Reviews
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Distributors
Contact Us

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Human SERPINA10 / PZI Protein (Recombinant 6His,C-terminus) (Leu22-Leu444) - LS-G39317

Catalog Size Price
LS-G39317-10 10 µg Unavailable
LS-G39317-50 50 µg Unavailable
LS-G39317-500 500 µg Unavailable
LS-G39317-1000 1000 µg Unavailable

Related Products

53 SERPINA10 / PZI Antibodies
4 SERPINA10 / PZI Elisa Kits
12 SERPINA10 / PZI Proteins

Most Popular SERPINA10 / PZI Proteins

Rat SERPINA10 / PZI Protein (Recombinant His + S) (aa6-125) - LS-G14615
E. coli Expression System
His + S
Purified / Lyophilized
Rat SERPINA10 / PZI Protein (Recombinant His + S) (aa278-425) - LS-G14616
E. coli Expression System
His + S
Purified / Lyophilized
Mouse SERPINA10 / PZI Protein (Recombinant His + GST) (aa22-448) - LS-G14617
E. coli Expression System
His + GST
Purified / Lyophilized
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Human SERPINA10 / PZI Protein (Recombinant His + GST) (aa24-444) - LS-G24598
E. coli Expression System
His + GST
Lyophilized
Human SERPINA10 / PZI Protein (Recombinant GST) (Full Length) - LS-G33654
Wheat Wheat Germ Extract
423 AA
GST
Purified
12.5% SDS-PAGE of human SERPINA10 stained with Coomassie Blue

100% Guaranteed
LS-G39317
Recombinant Protein
SERPINA10 / PZI
Human
49.5kD
Recombinant Human Serpin A10 is produced by our Mammalian expression system and the target gene encoding Leu22-Leu444 is expressed with a 6His tag at the C-terminus.
Leu22-Leu444
LAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLLLDHHHHHH
Human Cells
Human
6His,C-terminus
Greater than 95% by SDS-PAGE
Not Tested
Less than 1.0 EU/µg protein (determined by LAL method).
Lyophilized from 0.2 µm filtered 20 mM PB, pH 7.4, 150 mM NaCl, 1 mM GaCl2.
Lyophilized protein should be stored at less than -20°C. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at less than -20°C for 3 months.
For research use only.

About SERPINA10 / PZI

Q9UK55 NM_016186 NP_057270.1

SERPINA10 Protein, Serpin A10 Protein, PZI Protein, ZPI Protein

Inhibits activity of the coagulation protease factor Xa in the presence of PROZ, calcium and phospholipids. Also inhibits factor XIa in the absence of cofactors.
(More About SERPINA10 / PZI)
Requested From: 
Date Requested: 6/19/2018
Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number