Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G5514-10 10 µg $493 
PTPN7 / HEPTP Protein

Human PTPN7 / HEPTP Protein (Recombinant His) - LS-G5514

Human PTPN7 / HEPTP Protein (Recombinant His) - LS-G5514

Description:
PTPN7 / HEPTP Protein LS-G5514 is a Recombinant Human PTPN7 / HEPTP produced in E. coli with His tag(s). It is biologically active.
Price
Catalog Number
$493
LS-G5514-10
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
PTPN7 / HEPTP Protein LS-G5514 is a Recombinant Human PTPN7 / HEPTP produced in E. coli with His tag(s). It is biologically active.

Specifications

Type
Recombinant Protein
Target
PTPN7 / HEPTP
Synonyms
PTPN7 | BPTP-4 | Dual specificity phosphatase 1 | HEPTP | LC-PTP | PTPNI | LPTP
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Predicted Molecular Weight
43.1 kDa
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYW
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Specific activity is > 2000 unit/mg. Enzymatic activity was confirmed by measuring the amount of enzyme hydrolyzing 1 nmole of p-nitrophenyl phosphate (pNPP) per minute at 37°C, pH7.5 using 10 mM of substrate.
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 0.1 M NaCl, 1 mM DTT, 20% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About PTPN7 / HEPTP
P35236 NM_002832 NP_002823.3

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PTPN7 / HEPTP Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PTPN7 / HEPTP Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PTPN7 / HEPTP Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PTPN7 / HEPTP Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/19/2021