Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G21098-20 20 µg $311 
LS-G21098-100 100 µg (0.2 mg/ml) $408 
LS-G21098-1 1 mg $1,207 
Protein

Human PTPN5 / STEP Protein (Recombinant His-SUMO) (aa300-555) - LS-G21098

Human PTPN5 / STEP Protein (Recombinant His-SUMO) (aa300-555) - LS-G21098

Description:
PTPN5 / STEP Protein LS-G21098 is a Recombinant Human PTPN5 / STEP produced in E. coli aa 300-555 with His-SUMO tag(s).
Price
Catalog Number
$311
LS-G21098-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
PTPN5 / STEP Protein LS-G21098 is a Recombinant Human PTPN5 / STEP produced in E. coli aa 300-555 with His-SUMO tag(s).

Specifications

Type
Recombinant Protein
Target
PTPN5 / STEP
Synonyms
PTPN5 | Striatal enriched phosphatase | Striatum enriched phosphatase | PTPSTEP | STEP
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His-SUMO
Region
aa 300-555
Predicted Molecular Weight
45.4 kD
AA Sequence
LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About PTPN5 / STEP
P54829 NM_006906 AAA87555.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/25/2022