Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G22107-20 20 µg $311 
LS-G22107-100 100 µg $408 
LS-G22107-1 1 mg $1,207 
Protein

Human PSMB1 Protein (Recombinant GST) (aa29-241) - LS-G22107

Human PSMB1 Protein (Recombinant GST) (aa29-241) - LS-G22107

Description:
PSMB1 Protein LS-G22107 is a Recombinant Human PSMB1 produced in E. coli aa 29-241 with GST tag(s).
Price
Catalog Number
$311
LS-G22107-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
PSMB1 Protein LS-G22107 is a Recombinant Human PSMB1 produced in E. coli aa 29-241 with GST tag(s).

Specifications

Type
Recombinant Protein
Target
PSMB1
Synonyms
PSMB1 | Macropain subunit C5 | HC5 | PMSB1 | Proteasome gamma chain | Proteasome subunit beta 1 | Proteasome beta 1 subunit | Proteasome component C5 | Lmpc5 | Proteasome subunit beta type-1 | Proteasome subunit HC5 | PSC5
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST
Region
aa 29-241
Predicted Molecular Weight
50.9 kD
AA Sequence
RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About PSMB1
P20618 NM_002793 NP_002784.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/28/2022