Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G4604-10 10 µg $286 
LS-G4604-50 50 µg $484 
LS-G4604-1 1 mg $4,178 
Protein

Human PRMT1 Protein (Recombinant His) - LS-G4604

Human PRMT1 Protein (Recombinant His) - LS-G4604

Available for shipment within the USA only
Description:
PRMT1 Protein LS-G4604 is a Recombinant Human PRMT1 produced in E. coli with His tag(s). It is biologically active.
Price
Catalog Number
$286
LS-G4604-10

Available for USA Shipment Only
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
PRMT1 Protein LS-G4604 is a Recombinant Human PRMT1 produced in E. coli with His tag(s). It is biologically active.

Specifications

Type
Recombinant Protein
Target
PRMT1
Synonyms
PRMT1 | HRMT1L2 | HMT2 | ANM1 | HCP1 | IR1B4
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Predicted Molecular Weight
84.0 kDa
AA Sequence
MHHHHHHMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAM
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
10000 units/ml
Endotoxin
Not Tested
Presentation
40 mM Tris-HCl, pH 8.0, 4 mM MgCl2, 100 mM NaCl, 2 mM DTT, 40% Glycerol
Storage
Store at -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About PRMT1
Q99873 NM_001536 NP_001527.3

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/19/2021