Products
Services
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G4719-50 50 µg $545 
PPIL4 Protein

Human PPIL4 Protein (Recombinant His) - LS-G4719

Human PPIL4 Protein (Recombinant His) - LS-G4719

Description:
PPIL4 Protein LS-G4719 is a Recombinant Human PPIL4 produced in E. coli with His tag(s). It is biologically active.
Price
Catalog Number
$545
LS-G4719-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
PPIL4 Protein LS-G4719 is a Recombinant Human PPIL4 produced in E. coli with His tag(s). It is biologically active.

Specifications

Type
Recombinant Protein
Target
PPIL4
Synonyms
PPIL4 | PPIase | Cyclophilin-like protein PPIL4 | HDCME13P | Rotamase PPIL4
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Predicted Molecular Weight
59.4 kDa
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTGRGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMDIIKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPEPTREQLDSGRIGADEEIDDFKGRSAEEVEEIK
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Bio-Activity
Specific activity is > 190 nmoles/min/mg.
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 0.1 M NaCl, 2 mM DTT, 10% Glycerol
Storage
Store at -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About PPIL4
Q8WUA2 AF068298 Q8WUA2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PPIL4 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PPIL4 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PPIL4 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PPIL4 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/26/2021