Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G3259-100 100 µg (1 mg/ml) $351 
LS-G3259-500 500 µg $694 
NBP / NUBP1 Protein

Human NBP / NUBP1 Protein (Recombinant His) - LS-G3259

Human NBP / NUBP1 Protein (Recombinant His) - LS-G3259

Description:
NBP / NUBP1 Protein LS-G3259 is a Recombinant Human NBP / NUBP1 produced in E. coli with His tag(s).
Price
Catalog Number
$351
LS-G3259-100
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
NBP / NUBP1 Protein LS-G3259 is a Recombinant Human NBP / NUBP1 produced in E. coli with His tag(s).

Specifications

Type
Recombinant Protein
Target
NBP / NUBP1
Synonyms
NUBP1 | NBP | NBP 1 | Nucleotide binding protein 1 | Nucleotide-binding protein | Nucleotide-binding protein 1 | NBP1
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
PBS, pH 7.4, 1 mM DTT, 10% Glycerol
Storage
Short term: store at 2°C to 8°C for up to 1 week. Long term: aliquot and store at -20°C to -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About NBP / NUBP1
P53384 NM_002484 NP_002475.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

NBP / NUBP1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

NBP / NUBP1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

NBP / NUBP1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

NBP / NUBP1 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/19/2021