Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G29917-10 10 µg $469 
LS-G29917-25 25 µg $630 
MAPK11 / SAPK2 / p38 Beta Protein - 12.5% SDS-PAGE of human MAPK11 stained with Coomassie Blue

Human MAPK11 / SAPK2 / p38 Beta Protein (Recombinant GST) (Full Length) - LS-G29917

Human MAPK11 / SAPK2 / p38 Beta Protein (Recombinant GST) (Full Length) - LS-G29917

Available for shipment within the USA only
Description:
MAPK11 / SAPK2 / p38 Beta Protein LS-G29917 is a Recombinant Human MAPK11 / SAPK2 / p38 Beta produced in Wheat Germ Extract with GST tag(s).
Price
Catalog Number
$469
LS-G29917-10

Available for USA Shipment Only
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
MAPK11 / SAPK2 / p38 Beta Protein LS-G29917 is a Recombinant Human MAPK11 / SAPK2 / p38 Beta produced in Wheat Germ Extract with GST tag(s).

Specifications

Type
Recombinant Protein
Target
MAPK11 / SAPK2 / p38 Beta
Synonyms
MAPK11 | D-p38b | MAP kinase p38 beta | p38B | p38Beta | p38 beta | PRKM11 | SAPK2B | SAPK2 | p38-2 | MAP kinase 11 | MAPK 11 | p38BETA2
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST
Predicted Molecular Weight
67.8 kDa
AA Sequence
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
Expression System
Wheat Germ Extract
Source Species
Wheat
Purification
Glutathione Sepharose
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Storage
Store at -80°C. Aliquot to avoid freeze-thaw cycles. Best used within 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About MAPK11 / SAPK2 / p38 Beta
Q15759 NM_002751 NP_002742.3

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAPK11 / SAPK2 / p38 Beta Protein - 12.5% SDS-PAGE of human MAPK11 stained with Coomassie Blue
12.5% SDS-PAGE of human MAPK11 stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAPK11 / SAPK2 / p38 Beta Protein - 12.5% SDS-PAGE of human MAPK11 stained with Coomassie Blue
12.5% SDS-PAGE of human MAPK11 stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAPK11 / SAPK2 / p38 Beta Protein - 12.5% SDS-PAGE of human MAPK11 stained with Coomassie Blue
12.5% SDS-PAGE of human MAPK11 stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAPK11 / SAPK2 / p38 Beta Protein - 12.5% SDS-PAGE of human MAPK11 stained with Coomassie Blue
12.5% SDS-PAGE of human MAPK11 stained with Coomassie Blue

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/30/2022