Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G23013-20 20 µg $326 
LS-G23013-100 100 µg $436 
LS-G23013-500 500 µg $1,000 
LRP2 / Megalin Protein

Human LRP2 / Megalin Protein (Recombinant His) (aa1186-1389) - LS-G23013

Human LRP2 / Megalin Protein (Recombinant His) (aa1186-1389) - LS-G23013

Description:
LRP2 / Megalin Protein LS-G23013 is a Recombinant Human LRP2 / Megalin produced in Yeast aa 1186-1389 with His tag(s).
Price
Catalog Number
$326
LS-G23013-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
LRP2 / Megalin Protein LS-G23013 is a Recombinant Human LRP2 / Megalin produced in Yeast aa 1186-1389 with His tag(s).

Specifications

Type
Recombinant Protein
Target
LRP2 / Megalin
Synonyms
LRP2 | DBS | Glycoprotein 330 | gp330 | Megalin | LRP-2 | Calcium sensor protein
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Region
aa 1186-1389
Predicted Molecular Weight
24.2 kD
AA Sequence
NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE
Expression System
Yeast
Source Species
Yeast
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from 20mM Tris-HCl, pH 8.0, 0.5M NaCl, 3% Trehalose.
Reconstitution
Briefly centrifuge vial prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration).
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About LRP2 / Megalin
P98164 NM_004525 NP_004516.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

LRP2 / Megalin Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

LRP2 / Megalin Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

LRP2 / Megalin Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

LRP2 / Megalin Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/21/2021