LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
Human JAM3 Protein (Recombinant His) - LS-G18890
Protein
Catalog
Size
Price
LS-G18890-2
2 µg
$195
LS-G18890-10
10 µg
$255
LS-G18890-100
100 µg
$1,260

Popular JAM3 Proteins

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
AA Sequence Size: 234 AA
Tag: His
Format: Purified
Recombinant  Junctional Adhesion Molecule 3 By SDS-PAGE
Source: E. coli Expression System
Tag: His + T7
Format: Lyophilized
12.5% SDS-PAGE of human JAM3 stained with Coomassie Blue
Source: Wheat Wheat Germ Extract
AA Sequence Size: 310 AA
Tag: GST
Format: Purified
Purified recombinant protein JAM3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Source: Human HEK 293 Cells
AA Sequence Size: 407 AA
Tag: Myc + DDK
Format: Purified

Product Description

Human JAM3 Protein (Recombinant His) - LS-G18890

Specifications

Type
Recombinant Protein
Target
JAM3
Synonyms
JAM3, JAMC, Junctional adhesion molecule C, JAM-2, Junctional adhesion molecule 3, JAM-3, JAM-C
Species
Human
Predicted Molecular Weight
26.0 kDa
Description
JAM3 Human Recombinant produced in E. coli is a single polypeptide chain containing 234 amino acids (32-241) and having a molecular mass of 26.0 kDa.JAM3 is fused to a 24 amino acid His-tag at N-terminus and purified by proprietary chromatographic techniques.
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 0.2 M NaCl, 2 mM EDTA, 5 mM DTT, 50% Glycerol
Storage
Store at 4°C short term. Store at -20°C long term. Carrier protein recommended for long term storage or low concentration. Avoid multiple freeze-thaw cycles
Restrictions
For research use only.
About JAM3
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Q9BX67 NM_032801 NP_116190.3


Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 10/18/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy