Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G23529-2 2 µg $248 
LS-G23529-10 10 µg $319 
LS-G23529-100 100 µg $704 
LS-G23529-500 500 µg $3,026 
LS-G23529-1 1 mg $5,042 
ITLN1 / Omentin Protein

Human ITLN1 / Omentin Protein (Recombinant) - LS-G23529

Human ITLN1 / Omentin Protein (Recombinant) - LS-G23529

Description:
ITLN1 / Omentin Protein LS-G23529 is a Recombinant Human ITLN1 / Omentin produced in E. coli. It is low in endotoxin; Less than 5.0 EU/µg protein (determined by LAL method).
Price
Catalog Number
$248
LS-G23529-2
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
ITLN1 / Omentin Protein LS-G23529 is a Recombinant Human ITLN1 / Omentin produced in E. coli. It is low in endotoxin; Less than 5.0 EU/µg protein (determined by LAL method).

Specifications

Type
Recombinant Protein
Target
ITLN1 / Omentin
Synonyms
ITLN1 | Endothelial lectin HL-1 | Galactofuranose-binding lectin | HL1 | INTL | Intelectin-1 | ITLN-1 | LFR | HL-1 | Omentin | HIntL | ITLN
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Predicted Molecular Weight
35 kDa
AA Sequence
MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Less than 5.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from sterile filtered 10 mM sodium phosphate, 5:1 mannitol to protein, pH 7.5
Reconstitution
Reconstitute in sterile water to 0.1 mg/ml
Storage
Store at -20°C to -80°C for up to 1 year. Store at 4°C for up to 1 month or up to 3 months at -20°C to -80°C after reconstitution.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About ITLN1 / Omentin
Q8WWA0 NM_017625 NP_060095.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ITLN1 / Omentin Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ITLN1 / Omentin Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ITLN1 / Omentin Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ITLN1 / Omentin Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/16/2021