LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human IL6R / IL6 Receptor Protein (Recombinant) (aa20-365)

Best Seller
Catalog
Size
Price
LS-G27205-10
10 µg
$245
LS-G27205-50
50 µg (0.1 mg/ml)
$485
Description
IL6R / IL6 Receptor Protien LS-G27205 is Recombinant Human IL6R / IL6 Receptor aa 20-365 of P08887 produced in Hamster-Chinese It is biologically active and is low in endotoxin Less than 0.2 EU/µg protein (determined by LAL method)..
Type
Recombinant Protein
Target
IL6R / IL6 Receptor
Species
Human
Predicted Molecular Weight
54-56 kDa (SDS-PAGE)
Details
Interleukin-6 Receptor Alpha, also known as IL-6RA, IL-6R1 and CD126, belongs to the type I cytokine receptor family. It is mainly expressed on T cells, fibroblasts and macrophages. IL-6RA couples with gp130 to form the IL-6 receptor; IL-6RA binds specifically to IL-6 and depends on gp130 to transmit signals. IL-6RA dysfunction has been correlated with the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Soluble IL-6RA, which consists of only the extracellular domain of IL-6RA, acts as an agonist of IL-6 activity.
Region
aa 20-365 of P08887
AA Sequence
LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP
Expression System
CHO Cells
Source Species
Hamster-Chinese
Purification
Greater than 95% by SDS-PAGE and HPLC
Bio-Activity
ED50 < 0.2 µg/ml, measured in a cell proliferation assay using M1 cells in the presence of 10 ng/ml human IL-6.
Endotoxin
Less than 0.2 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from PBS
Reconstitution
ddH2O or PBS at 100 ug/ml
Storage
Stable at -80°c for up to 6 months. Upon reconstitution, store at 4°c for up to 1 week or at -20°c for up to 2 months.
Restrictions
For research use only.
About IL6R / IL6 Receptor
P08887 NM_000565 NP_000556.1

Popular IL6R / IL6 Receptor Proteins

Protein
Source: Hamster-Chinese CHO Cells
Tag: Mouse IgG2 Fc
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.06 EU/µg protein (determined by LAL method).
Protein
Source: Human HEK 293 Cells
AA Sequence Size: 339 AA
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Recombinant Interleukin 6 Receptor By SDS-PAGE
Source: E. coli Expression System
Tag: His
Format: Purified / Lyophilized
Protein
Source: Hamster-Chinese CHO Cells
Tag: Human IgG1 Fc
Format: Purified / Lyophilized / Endotoxin Level: Less than 0.06 EU/µg protein (determined by LAL method).

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 1/23/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy