Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G23654-2 2 µg $205 
LS-G23654-10 10 µg $285 
LS-G23654-100 100 µg $475 
LS-G23654-500 500 µg $1,995 
LS-G23654-1 1 mg $3,330 
IL3 Protein

Human IL3 Protein (Recombinant) - LS-G23654

Human IL3 Protein (Recombinant) - LS-G23654

Description:
IL3 Protein LS-G23654 is Recombinant Human IL3 in E. coli It is biologically active and is low in endotoxin Less than 1.0 EU/µg protein (determined by LAL method)..
Price
Catalog Number
$205 
LS-G23654-2
Toll Free North America
866-819-4732

Overview

Description:
IL3 Protein LS-G23654 is Recombinant Human IL3 in E. coli It is biologically active and is low in endotoxin Less than 1.0 EU/µg protein (determined by LAL method)..

Specifications

Type
Recombinant Protein
Target
IL3
Species
Human
Modifications
Animal-free
Predicted Molecular Weight
15.2 kDa
AA Sequence
MAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Tested using: TF-1 cell proliferation. Less than or equal to 2 ng/mL and greater than or equal to 5.0 x 10^5 units/mg. The specific activity of Human IL-3 is approximately 4.2 x 10^3 IU/µg, which is calibrated against recombinant human IL-3 WHO International Standard (NIBSC code: 91/510).
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
Reconstitution
Reconstitute in sterile water to 0.1 mg/ml
Storage
Store at -20°C to -80°C for up to 1 year. Store at 4°C for up to 1 month or up to 3 months at -20°C to -80°C after reconstitution.
Restrictions
For research use only.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL3
P08700 NM_000588 NP_000579.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL3 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL3 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL3 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IL3 Protein

Requested From: United States
Date Requested: 11/22/2019