LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
Human IL1F9 Protein (Recombinant) - LS-G3657
Catalog
Size
Price
LS-G3657-2
2 µg
$225
LS-G3657-10
10 µg
$295
Description
Human IL1F9 Protein (Recombinant) - LS-G3657
Type
Animal-Free  Recombinant Protein
Target
IL1F9
Species
Human
Details
The IL-1 family is comprised of 11 structurally related ligands, including recently re-named IL-36 alpha (IL-1F6), beta (IL-1F8) and gamma (IL-1F9). IL-36gamma is highly expressed in psoriatic plaques and in tissues containing epithelial cells. IL-36gamma signals through the IL-1Rrp2 (IL-1R6) receptor, which is primarily expressed on certain dendritic cells. The interaction of the IL-1Rrp2 receptor with IL-36 ligands induces dendritic cell maturation and activation. IL-36gamma also functions as an agonist of NF-kappaB, and can stimulate the inflammatory response in bronchial epithelial cells. Recombinant human IL-36gamma is a 17.0 kDa protein containing 152 amino acid residues.
AA Sequence
SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE and HPLC
Bio-Activity
Measured by its ability to induce IL-8 production by human PBMCs.
Endotoxin
Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Storage
If lyophilized, can be stored for 1 month at room temperature, 6 months at 4°C, or through the expiration date at -20°C to -80°C. Once reconstituted per the supplied instructions, can be stored for 3 months at -20°C to -80°C, or for 1 week at 2°C to 8°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About IL1F9
Q9NZH8 NM_019618 NP_062564.1

Popular IL1F9 Proteins

Protein
Source: E. coli Expression System
AA Sequence Size: 152 AA
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
AA Sequence Size: 192 AA
Tag: His
Format: Purified
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.01 EU/µg protein (determined by LAL method).
Protein
Source: E. coli Expression System
Tag: DDK
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.01 EU/µg protein (determined by LAL method).

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 12/11/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy