LSBio
Products
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Immunohistochemistry Reagents
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
Services
  • Immunohistochemistry Services

    • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

    • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question? CustomerSupport@LSBio.com
Research Areas
  • Cancer Research:
  • Breast Cancer IHC
  • Colorectal Cancer IHC
  • Lung Cancer IHC
  • Prostate Cancer IHC
  • Cell Cycle:
  • Apoptosis
  • Protein Family and Group:
  • Caspases
  • Chemokines
Resources
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Reviews
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Distributors
Contact Us

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Human IL17F Protein (Recombinant) - LS-G4316

Catalog Size Price
LS-G4316-10 10 µg Unavailable
LS-G4316-50 50 µg Unavailable
LS-G4316-1 1 mg Unavailable

Related Products

80 IL17F Antibodies
19 IL17F Elisa Kits
44 IL17F Proteins

Most Popular IL17F Proteins

Mouse IL17F Protein (Recombinant) - LS-G15
E. coli Expression System
134 AA
None
Purified / Lyophilized / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Human IL17F Protein (Recombinant) - LS-G179
E. coli Expression System
134 AA
None
Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Human IL17F Protein (Recombinant His) - LS-G2432
E. coli Expression System
158 AA
His
Purified
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Human IL17F Protein (Recombinant) - LS-G3648
E. coli Expression System
134 AA
None
Purified / Lyophilized / Biologically Active / Animal-Free / Endotoxin Level: Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Human IL17F Protein (Recombinant) - LS-G4857
Human HEK 293 Cells
None
Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 1.0 EU/µg protein.
Functional Assay Image

100% Guaranteed
LS-G4316
Recombinant Protein
IL17F
Human
30.7 kDa
MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVL
E. coli
E. coli
None
Greater than 98% by SDS-PAGE
Not Tested
Not Tested
Lyophilized
Centrifuge the vial before opening. Reconstitute with sterile water to a concentration not more than 1 mg/ml; This solution can then be diluted into other aqueous buffers.
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.

About IL17F

Q96PD4 Q96PD4

IL17F Protein, CANDF6 Protein, Cytokine ML-1 Protein, IL-17F Protein, Interleukin-17F Protein, Interleukin 17F Protein, Interleukin-24 Protein, ML-1 Protein, ML1 Protein, Mutant IL-17F Protein

Stimulates the production of other cytokines such as IL-6, IL-8 and granulocyte colony-stimulating factor, and can regulate cartilage matrix turnover. Stimulates PBMC and T-cell proliferation. Inhibits angiogenesis.
(More About IL17F)
Requested From: 
Date Requested: 6/19/2018
Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number