LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human IL17F Protein (Recombinant)

Catalog
Size
Price
LS-G134054-5
5 µg
$205
LS-G134054-25
25 µg
$285
LS-G134054-100
100 µg
$475
LS-G134054-500
500 µg
$1,995
LS-G134054-1
1 mg
$3,330
Description
Human IL17F Protein (Recombinant) - LS-G134054
Type
Animal-Free  Recombinant Protein
Target
IL17F
Species
Human
Predicted Molecular Weight
15.0 kDa (monomer), 30.1 kDa (dimer)
Details
Interleukin 17F (IL-17F), a member of the IL-17 cytokine family, is secreted by activated CD4+ T cells and monocytes. IL-17F binds the IL-17 receptor related molecule, IL17RC, to promote the production of the interleukin 6 (IL-6), interleukin 8 (IL-8), and granulocyte macrophage colony-stimulating factor (GM-CSF) cytokines. IL-17F also functions to regulate matrix turnover rates, inhibit endothelial cell angiogenesis, and induce the endothelial cell expression of interleukin 2 (IL-2), monocyte chemoattractant protein-1 (MCP-1), and transforming growth factor beta 1 (TGF-b1).
AA Sequence
MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by reducing and non-reducing SDS-PAGE
Bio-Activity
Determined by Production of IL-6 From Mouse 3T3 Cells; <= 100 ng/ml; >= 1.0x10^4 units/mg
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from 0.1% TFA
Reconstitution
Centrifuge vial before opening. Reconstitute with sterile water at 0.1 mg/mL. Suspend the product by gently pipetting the recommended solution down the sides of the vial. Do not vortex. Allow several minutes for complete reconstitution.
Storage
Shipped at room temperature. Prior to reconstitution, store at -20°C. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution. Store at -80°C and avoid freeze-thaw cycles.
Restrictions
For research use only.
About IL17F
Q96PD4 Q96PD4

Popular IL17F Proteins

Functional Assay Image
Source: Human HEK 293 Cells
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 1.0 EU/µg protein.
Protein
Source: E. coli Expression System
AA Sequence Size: 134 AA
Tag: None
Format: Purified / Lyophilized / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Protein
Source: E. coli Expression System
AA Sequence Size: 134 AA
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
AA Sequence Size: 158 AA
Tag: His
Format: Purified
Protein
Source: E. coli Expression System
AA Sequence Size: 134 AA
Tag: None
Format: Purified / Lyophilized / Biologically Active / Animal-Free / Endotoxin Level: Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).

Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot

Western blot

Western blot


Requested From: United States
Date Requested: 1/23/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy