Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G23652-20 20 µg $215 
LS-G23652-100 100 µg $285 
LS-G23652-250 250 µg $455 
LS-G23652-500 500 µg $740 
LS-G23652-1 1 mg $1,290 
IFN Gamma / Interferon Gamma Protein

Human IFN Gamma / Interferon Gamma Protein (Recombinant) - LS-G23652

Human IFN Gamma / Interferon Gamma Protein (Recombinant) - LS-G23652

Description:
IFN Gamma / Interferon Gamma Protein LS-G23652 is Recombinant Human IFN Gamma / Interferon Gamma in E. coli and is low in endotoxin Less than 1.0 EU/µg protein (determined by LAL method)..
Price
Catalog Number
$215 
LS-G23652-20
Toll Free North America
866-819-4732

Overview

Description:
IFN Gamma / Interferon Gamma Protein LS-G23652 is Recombinant Human IFN Gamma / Interferon Gamma in E. coli and is low in endotoxin Less than 1.0 EU/µg protein (determined by LAL method)..

Specifications

Type
Recombinant Protein
Target
IFN Gamma / Interferon Gamma
Synonyms
IFNG | IFG | Immune interferon | IFI | Interferon gamma | IFN-gamma | Interferon, gamma | IFNY
Species
Human
Modifications
Animal-free
Conjugations
Unconjugated
Predicted Molecular Weight
16.9 kDa
AA Sequence
MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE
Usage Summary
If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate.
Bio-Activity
Tested using: Viral CPE assay using EMC virus on A549 cells. and greater than or equal to 1.0 x 10^7 units/mg.
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from a sterile filtered solution 10 mM sodium phosphate, pH 7.5, 50 mM sodium chloride
Reconstitution
Reconstitute in sterile water to 0.1 mg/ml
Storage
Store at -20°C to -80°C for up to 1 year. Store at 4°C for up to 1 month or up to 3 months at -20°C to -80°C after reconstitution.
Restrictions
For research use only.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About IFN Gamma / Interferon Gamma
P01579 NM_000619 NP_000610.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IFN Gamma / Interferon Gamma Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IFN Gamma / Interferon Gamma Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IFN Gamma / Interferon Gamma Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

IFN Gamma / Interferon Gamma Protein

Requested From: United States
Date Requested: 2/17/2020