Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G16986-2 2 µg $195 
LS-G16986-10 10 µg $255 
LS-G16986-1 1 mg $4,950 
Protein

Human GMF Beta / GMFB Protein (Recombinant) - LS-G16986

Human GMF Beta / GMFB Protein (Recombinant) - LS-G16986

Description:
GMF Beta / GMFB Protein LS-G16986 is Recombinant Human GMF Beta / GMFB in E. coli
Price
Catalog Number
$195 
LS-G16986-2
Toll Free North America
866-819-4732

Overview

Description:
GMF Beta / GMFB Protein LS-G16986 is Recombinant Human GMF Beta / GMFB in E. coli

Specifications

Type
Recombinant Protein
Target
GMF Beta / GMFB
Species
Human
Modifications
Unmodified
Predicted Molecular Weight
16.5 kDa
AA Sequence
SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 98% by SDS-PAGE and RP-HPLC
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from 0.13 M NaCl
Storage
Store at -20°C. Store at 4°C after reconstitution between 2-7 days. Carrier protein recommended for long term storage or low concentration. Avoid multiple freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About GMF Beta / GMFB
P60983 NM_004124 NP_004115.1

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 12/14/2019