Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G61707-2 2 µg $421 
GLIPR1 / GLIPR Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.

Human GLIPR1 / GLIPR Protein (Recombinant GST, N-terminus) (aa23-99) - LS-G61707

Human GLIPR1 / GLIPR Protein (Recombinant GST, N-terminus) (aa23-99) - LS-G61707

Available for shipment within the USA only
Description:
GLIPR1 / GLIPR Protein LS-G61707 is a Recombinant Human GLIPR1 / GLIPR produced in Wheat Germ Extract aa 23-99 with GST, N-terminus tag(s).
Price
Catalog Number
$421
LS-G61707-2

Available for USA Shipment Only
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
GLIPR1 / GLIPR Protein LS-G61707 is a Recombinant Human GLIPR1 / GLIPR produced in Wheat Germ Extract aa 23-99 with GST, N-terminus tag(s).

Specifications

Type
Recombinant Protein
Target
GLIPR1 / GLIPR
Synonyms
GLIPR1 | CRISP7 | GliPR 1 | GLIPR | RTVP1 | GLI pathogenesis-related 1 | Protein RTVP-1
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST, N-terminus
Region
aa 23-99
AA Sequence
NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN
Expression System
Wheat Germ Extract
Source Species
Wheat
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Storage
Store at -80°C. Aliquot to avoid freeze-thaw cycles. Best used within 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About GLIPR1 / GLIPR
P48060 NM_006851 NP_006842.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GLIPR1 / GLIPR Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GLIPR1 / GLIPR Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GLIPR1 / GLIPR Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GLIPR1 / GLIPR Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/24/2021