LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human FLT3LG / Flt3 Ligand Protein (Recombinant) (aa27-181) - LS-G5761

Catalog
Size
Price
LS-G5761-2
2 µg
$225
LS-G5761-10
10 µg
$315
LS-G5761-100
100 µg
$725
LS-G5761-250
250 µg
$1,260
Description
FLT3LG / Flt3 Ligand Protein LS-G5761 is Recombinant Human FLT3LG / Flt3 Ligand aa 27-181 produced in E. coli It is biologically active
Type
Recombinant Protein
Target
FLT3LG / Flt3 Ligand
Species
Human
Predicted Molecular Weight
17.6 kDa
Region
aa 27-181
AA Sequence
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 97% by SDS-PAGE and HPLC
Bio-Activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human AML5 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 x 106 IU/mg.
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Reconstitution
Reconstitute in sterile distilled water to 0.1-1 mg/ml.
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only.
About FLT3LG / Flt3 Ligand
P49771 NM_001459 NP_001450.2

Popular FLT3LG / Flt3 Ligand Proteins

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein.
Protein
Source: Human Human Cells
Tag: 6His,C-terminus
Format: Purified / Lyophilized / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).

Publications (0)


Customer Reviews (0)


Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis


Requested From: United States
Date Requested: 6/16/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy