LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human FLT3LG / Flt3 Ligand Protein (Recombinant) - LS-G17081

Catalog
Size
Price
LS-G17081-2
2 µg
$195
LS-G17081-10
10 µg
$255
LS-G17081-100
100 µg
$1,155
Description
FLT3LG / Flt3 Ligand Protein LS-G17081 is Recombinant Human FLT3LG / Flt3 Ligand in Human It is biologically active
Type
Recombinant Protein
Target
FLT3LG / Flt3 Ligand
Species
Human
Details
Flt3-Ligand Human Recombinant produced in HEK293 cells is a glycosylated, polypeptide chain, migrates as a diffuse band on SDS-PAGE due to heterogeneous glycosylation at 30kDa. Flt3-Ligand is purified by proprietary chromatographic techniques.
AA Sequence
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP
Expression System
HEK 293 Cells
Source Species
Human
Purification
Greater than 95% by SDS-PAGE and RP-HPLC
Bio-Activity
The ED50 as determined by the dose dependent proliferation of human OCI-AML5 cells is 0.5 to 1.0 ng/ml (Specific Activity: 2.0 x 1,000,000 - 1.0 x 1,000,000 units/mg).
Endotoxin
Not Tested
Presentation
Lyophilized without additives.
Storage
Store at -20°C. Store at 4°C after reconstitution between 2-7 days. Carrier protein recommended for long term storage or low concentration. Avoid multiple freeze-thaw cycles.
Restrictions
For research use only.
About FLT3LG / Flt3 Ligand
P49771 NM_001459 NP_001450.2

Popular FLT3LG / Flt3 Ligand Proteins

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein.
Protein
Source: Human Human Cells
Tag: 6His,C-terminus
Format: Purified / Lyophilized / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 2/17/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy