LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human FGL1 / Hepassocin Protein (Over-Expression Lysate Myc + DDK) (Full Length) - LS-G116625

Available for shipment within the USA only
Catalog
Size
Price
LS-G116625-100
100 µg (1 mg/ml)
$365

Available for shipment within the USA only
Description
FGL1 / Hepassocin Protein LS-G116625 is Over-Expression Lysate Human FGL1 / Hepassocin in Human with Myc + DDK tag(s).
Type
Over-Expression Lysate Protein
Target
FGL1 / Hepassocin
Species
Human
Predicted Molecular Weight
36.38 kDa Full Length
Details
This product includes lysate of HEK293T cells that have been transiently-tranfected with Human FGL1 (NM_004467), cells transfected with the vector alone, and a reducing buffer for SDS-Page gel loading. Cells were lysed using Modified RIPA buffer (25mM Tris-HCl pH 7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF, and 1mM Na3VO4).
AA Sequence
MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI(CloningSiteandTags:myc-FLAG tag)
Expression System
HEK 293 Cells
Source Species
Human
Purification
Unpurified
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4.
Storage
Store at -80°C. Avoid freeze-thaw cycles. After incubation with SDS-PAGE sample buffer, SDS-PAGE samples need to be stored in -20°C for long term storage.
Usage Summary
Intended for use as a Western blot control. Spin down briefly and dilute with equal volume of 2xSDS Sample Buffer provided (4% SDS, 125mM Tris-HCl pH6.8, 10% Glycerol, 0.002% Bromphenol blue, 100mM DTT). Prior to SDS-PAGE fractionation, boil the lysate for 5-10 minutes.
Restrictions
For research use only. Available for shipment within the USA only.
About FGL1 / Hepassocin
Q08830 NM_004467 NP_004458.3

Popular FGL1 / Hepassocin Proteins

Recombinant Fibrinogen Like Protein 1 By SDS-PAGE
Source: E. coli Expression System
Tag: His, N-Terminal
Format: Purified / Lyophilized
Purified recombinant protein FGL1 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Source: Human HEK 293 Cells
Tag: Myc + DDK
Format: Purified
Recombinant Fibrinogen Like Protein 1 By SDS-PAGE
Source: E. coli Expression System
Tag: His, N-Terminal
Format: Purified / Lyophilized
12.5% SDS-PAGE of human FGL1 stained with Coomassie Blue
Source: Wheat Wheat Germ Extract
Tag: GST
Format: Purified

Publications (0)


Customer Reviews (0)


Images

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Requested From: United States
Date Requested: 5/20/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy